Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MENQEVVLSIDAIQEPEQIKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKMFTQAFQNLTLESGETYDFSDVWKEVPEPGTYEVKVTFKGRAENLKQVQAVQQFEVK 3IDU Chain:A ((31-100)) --------------VNKLAEYEVHVKNLGGIGV-------PSTKVRVYI-NGTLY--------KNW---TVSLGPKEEKVLTFNWT-PTQEGMYRINATVDEEN---------------

General information: TITO was launched using: RESULT: Template: 3IDU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 238 -17754 -74.60 -253.63 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -74.60 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.602

(partial model without unconserved sides chains): PDB file : Tito_3IDU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IDU-query.scw PDB file : Tito_Scwrl_3IDU.pdb: