Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELLQ 1IGD Chain:A ((36-61)) --------------------------KQYANDNGVDGVWTYDDATKTFTVTE---------------------------

General information: TITO was launched using: RESULT: Template: 1IGD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 45 -4029 -89.52 -154.94 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -89.52 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.498

(partial model without unconserved sides chains): PDB file : Tito_1IGD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IGD-query.scw PDB file : Tito_Scwrl_1IGD.pdb: