Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVCLMTGEITSENKEYGNGKITLSPEGAQLLLEEIQAALKE 2K1N Chain:C ((1-54)) MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTC--------------------------------------

General information: TITO was launched using: RESULT: Template: 2K1N.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 93 -9148 -98.37 -169.41 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain C : 0.77 3D Compatibility (PKB) : -98.37 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.446

(partial model without unconserved sides chains): PDB file : Tito_2K1N.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K1N-query.scw PDB file : Tito_Scwrl_2K1N.pdb: