Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIAKMMEALD-----GERFDIIMEKTLKGM--TRVMIWGCL-PYFLYVLIRMFTN------------ 3ERM Chain:A ((21-87)) VDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVFAAAFKNNATALSELSEPA

General information: TITO was launched using: RESULT: Template: 3ERM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 72 1225 17.01 26.05 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 17.01 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.243

(partial model without unconserved sides chains): PDB file : Tito_3ERM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3ERM-query.scw PDB file : Tito_Scwrl_3ERM.pdb: