Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKQQFIDMQEQGTSTIPNLLLTHYKQLGLNETELILLLKIKMHLEKGSYFPTPNQLQEGMSISVEECTNRLRMFIQKGFLFIEECEDQNGIKFEKYSLQPLWGKLYEYIQLAQNQTQERKAEGEQKSLYTIFEEE-FARPLSPLECETLAIWQDQD-------QHDAQLIKHALKEAVLSGKLSFRYIDRILFEWKKNGLKTVEQAKIHSQKFRRVQAKQNEPQKEYKRQVPFYNWLEQ 2I5U Chain:A ((2-75)) --------------------------------------------------------------------------------------------------------------------------------IRSIWENNGFG-LMSSKTMTDFDYWISDFEKIGASQKEAEQLIVKAIEIAIDANARNYNYINAILKDWEQRGFKS-------------------------------------

General information: TITO was launched using: RESULT: Template: 2I5U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 186 -5690 -30.59 -86.21 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -30.59 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.819

(partial model without unconserved sides chains): PDB file : Tito_2I5U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2I5U-query.scw PDB file : Tito_Scwrl_2I5U.pdb: