Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------------------------------------------------------MIIAAYLVLINLCGFWVMGIDKRKAQQHKWRISEDRLWLIAIVFGAL---GVWLGMQTFRHKTKHASFKYGVPLLLVIEAILIAIYYSPFDL
5FIK Chain:W ((10-226))ITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSIHNSKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNKTKASLAHFLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT


General information:
TITO was launched using:
RESULT:

Template: 5FIK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 230 -28400 -123.48 -319.10
target 2D structure prediction score : 0.56
Monomeric hydrophicity matching model chain W : 0.49

3D Compatibility (PKB) : -123.48
2D Compatibility (Sec. Struct. Predict.) : 0.56
1D Compatibility (Hydrophobicity) : 0.49
QMean score : 0.131

(partial model without unconserved sides chains):
PDB file : Tito_5FIK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5FIK-query.scw
PDB file : Tito_Scwrl_5FIK.pdb: