Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKPVMLSVYGAENVCASCVNMPTAKDTYEWLEAALKRKYPNQPFEMQYIDIHEPPDNEHA-KELAEKIRNDEYFYPLVLVEDKIVGEGNPKLKDVYEEMEKHGYTENR 2MYG Chain:A ((12-78)) ---GNKVVVFSWVT-CPYCVRAEK------LLHAR--------TKDITVHYVDKMSEGEQLRGEIYQAY--KHETVPAIFINGNFIG----------------------

General information: TITO was launched using: RESULT: Template: 2MYG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 203 -29001 -142.86 -439.41 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -142.86 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.453

(partial model without unconserved sides chains): PDB file : Tito_2MYG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MYG-query.scw PDB file : Tito_Scwrl_2MYG.pdb: