Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAFDKQKLDVTNDVTGRFQNGRLSLYHDNEMIGQMTSMNEYELKSGYSFENEKFYKTADVVSGDDAKYVDCDYENGWC 3R4Z Chain:A ((199-252)) -SFDSHKV---HDPCLMFFNNRFYLYYKGETMGESMNMGGREIKHGVAIADSPL------------------------

General information: TITO was launched using: RESULT: Template: 3R4Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 144 1263 8.77 25.25 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 8.77 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.106

(partial model without unconserved sides chains): PDB file : Tito_3R4Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3R4Z-query.scw PDB file : Tito_Scwrl_3R4Z.pdb: