Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------MNRSGKHLISSIILYPRPSGECI--SSISLDKQTQATTSPLYFCWREK--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1DKG Chain:D ((3-383))KIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQD-----GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKTGNRTIAVYDLGGGTFDISIIEIDEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIELLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLT


General information:
TITO was launched using:
RESULT:

Template: 1DKG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 126 -1893 -15.02 -46.16
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain D : 0.54

3D Compatibility (PKB) : -15.02
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.54
QMean score : 0.358

(partial model without unconserved sides chains):
PDB file : Tito_1DKG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1DKG-query.scw
PDB file : Tito_Scwrl_1DKG.pdb: