Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYLGIVSTACAFLLWNHGLQLLNASSGGLFFFFQPLVGTLLGWILLGEQIGGTFWIGSFLILSGVLLVIKEKEKEVKS 2LW6 Chain:A ((43-54)) ----------------------------------------WAVRFYEEKPGQ--------------------------

General information: TITO was launched using: RESULT: Template: 2LW6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 178 178.00 14.83 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain A : 0.41 3D Compatibility (PKB) : 178.00 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.41 QMean score : 0.335

(partial model without unconserved sides chains): PDB file : Tito_2LW6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LW6-query.scw PDB file : Tito_Scwrl_2LW6.pdb: