Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIHPPQKNSDEGTLFLSSNLFAPPKIPSNPRTPVLLAFYRIVNITQNHTANKKRNIFSTHSLKAQTKHYKFEISWYIFLHEFSTNCIFMIEFQLS 4MYS Chain:B ((3-27)) -------------------------------------------------------------LHAQAKHGKPGLPWLVFLHGFSGDC---------

General information: TITO was launched using: RESULT: Template: 4MYS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 24 -3919 -163.27 -156.74 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -163.27 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.166

(partial model without unconserved sides chains): PDB file : Tito_4MYS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4MYS-query.scw PDB file : Tito_Scwrl_4MYS.pdb: