Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKG-NEAEVIQIMSTNP-MHFLHPDISPGQKLKLNV 3H0G Chain:E ((151-193)) -------------------------LSPDEKKELLDRYKLRETQLPRIQLADPVARYLG--LKRGEVVKI--

General information: TITO was launched using: RESULT: Template: 3H0G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 73 -9601 -131.52 -234.17 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain E : 0.63 3D Compatibility (PKB) : -131.52 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.027

(partial model without unconserved sides chains): PDB file : Tito_3H0G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3H0G-query.scw PDB file : Tito_Scwrl_3H0G.pdb: