Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVLCDDERSAFLLVLDERLVDFDSQGGNHISVYLVTHFELSDQSYKDVLSFNDDLLGMEHNCSYAMDILSVKEELDFDFPFNMLAIKSYVQELIKMLGIDITLPEMKERDFDKLSQN 4K5O Chain:A ((740-767)) -----------------------------VSAYFDKYFELYDKTYK--LSKDDELLLQE----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4K5O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 28 911 32.52 32.52 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : 32.52 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.116

(partial model without unconserved sides chains): PDB file : Tito_4K5O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4K5O-query.scw PDB file : Tito_Scwrl_4K5O.pdb: