Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEPYQRYEELKKKTIKVVQKENYS---IRYITQDEASNDLDEFYKQF--AQHLLEAALERKAE------------------------------------------------------------------------------------------------------------------------ 5CXI Chain:A ((18-198)) --QRERRKRILDATMAIASKGGYEAVQMRAVADR-ADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIG

General information: TITO was launched using: RESULT: Template: 5CXI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 183 1083 5.92 19.69 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : 5.92 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.645

(partial model without unconserved sides chains): PDB file : Tito_5CXI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5CXI-query.scw PDB file : Tito_Scwrl_5CXI.pdb: