Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYWIEWIENGEKKNIVAEGWIEWAAILEDLYQKRFEYVEWKRL 3TJ5 Chain:B ((1-27)) ---------GSHMN-----LLNAATALSGSMQYLLNYVNAG--

General information: TITO was launched using: RESULT: Template: 3TJ5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 6 697 116.17 25.81 target 2D structure prediction score : 0.93 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : 116.17 2D Compatibility (Sec. Struct. Predict.) : 0.93 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.401

(partial model without unconserved sides chains): PDB file : Tito_3TJ5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3TJ5-query.scw PDB file : Tito_Scwrl_3TJ5.pdb: