Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLGRTKLGNRNAQANNNAKKKNGFQTHFDSYAGREAEKLIASNKRHND--------------- 2C9L Chain:Y ((1-63)) MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD

General information: TITO was launched using: RESULT: Template: 2C9L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Y - contact count / total energy / energy per contact / energy per residue : 3 522 173.83 10.86 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain Y : 0.60 3D Compatibility (PKB) : 173.83 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.441

(partial model without unconserved sides chains): PDB file : Tito_2C9L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2C9L-query.scw PDB file : Tito_Scwrl_2C9L.pdb: