Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYKKSSSK 4OXP Chain:A ((193-254)) -------------------------------------------GGGISRKITAVTDRKRLKSVVQSLD------V-PQGMGLIVRTAGAKRTKAEIKRDYEYLLRLWENIRE----

General information: TITO was launched using: RESULT: Template: 4OXP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 161 -20089 -124.77 -324.01 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -124.77 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.546

(partial model without unconserved sides chains): PDB file : Tito_4OXP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OXP-query.scw PDB file : Tito_Scwrl_4OXP.pdb: