Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--ATCN--ALQLTPCAGAIVGN--AAPTASCCSKMKE-QQPCMCQYARDPNLKQY-VDSPNGKKVMAACKVPVP-SC
2RKN Chain:A ((1-77))AIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELASALPKQCGLANAPTC


General information:
TITO was launched using:
RESULT:

Template: 2RKN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -18080 for 416 contacts (-43.5/contact) +
2D Compatibility (PS) -6726 + (NN) -2104 + (LL) 0
1D Compatibility (HY) -5600 + (ID) 800
Total energy: -33310.0 ( -80.07 by residue)
QMean score : 0.381

(partial model without unconserved sides chains):
PDB file : Tito_2RKN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2RKN-query.scw
PDB file : Tito_Scwrl_2RKN.pdb: