Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMLPDKIIYEGKAKFIIETKDPLTVIQYFKDEVTAFNKEKYKIIEGKGTINNRISTFIMETLEKAGINTHFIKTLSEREQLVKKLKIIPLEIVVRNIAAGSFCKRFNIKEGEKLAFPIIEFFYKNDGLADPMVNENHVLYFGWLSYEEMEEIKTITIKINTVLIDLFLNAGIDLVDLKLEFGRPINDNTKITLADEISPDNCRLWDKNTHKKLDKDVFRLNLGNLKEAYLEVAKRLSVKLC
4O7W Chain:A ((7-232))------VYEGKAKKMIPIDDDKLIME-FKDDATAFDGTKKARFKGKGWLNAQLSVIFFKLLEEHGIKTHFIGVAGGNRLIVEKLDMYPLEVVVRNVVAGSLKKRLPLPEGYELPEPIVELYYKNDELHDPMINYYHAKVLG-ISLDEIKKIEEIALKVNEILKDYLAKKGIILVDFKLEFGK--DKNGDIVLADEISPDTCRFWDAKTKRSLDKDVFRFDKGDLIEAYKEIYERITGEKP


General information:
TITO was launched using:
RESULT:

Template: 4O7W.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -73577 for 1744 contacts (-42.2/contact) +
2D Compatibility (PS) -24358 + (NN) -3184 + (LL) 748
1D Compatibility (HY) -23600 + (ID) 5300
Total energy: -129271.0 ( -74.12 by residue)
QMean score : 0.365

(partial model without unconserved sides chains):
PDB file : Tito_4O7W.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4O7W-query.scw
PDB file : Tito_Scwrl_4O7W.pdb: