Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------------------------MSGYSNGGGYGG-ISSFALIVVLFILLII-VGTAFVGGF----------------------------------------------------------------------------------------- 4RZ9 Chain:A ((1-179)) MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEP

General information: TITO was launched using: RESULT: Template: 4RZ9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 59 -9266 -157.05 -250.43 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -157.05 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.338

(partial model without unconserved sides chains): PDB file : Tito_4RZ9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4RZ9-query.scw PDB file : Tito_Scwrl_4RZ9.pdb: