Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGIWNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT 1DJ7 Chain:B ((1-73)) -------------MNVGDRVRVTS-SVVVYHHPEHKKTAFDLQ-----GMEGEVAAVLTEWQGRP-ISANLPVLVKFEQRFKAHFRPDEVTLI---------------------

General information: TITO was launched using: RESULT: Template: 1DJ7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 270 -51223 -189.71 -701.68 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain B : 0.51 3D Compatibility (PKB) : -189.71 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.057

(partial model without unconserved sides chains): PDB file : Tito_1DJ7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DJ7-query.scw PDB file : Tito_Scwrl_1DJ7.pdb: