Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------MDYADYDKALYYTHRSQWDNLLILMVRTEDD---LLSKRIEHFLHAYHFEQDYAV----LEKMLYSLLRYIDHATELTYEDQIALLT---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5A1F Chain:A ((1-458))SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDK-LHFTPRIQRLNELEAQTRVRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE


General information:
TITO was launched using:
RESULT:

Template: 5A1F.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 160 -10947 -68.42 -138.57
target 2D structure prediction score : 0.48
Monomeric hydrophicity matching model chain A : 0.50

3D Compatibility (PKB) : -68.42
2D Compatibility (Sec. Struct. Predict.) : 0.48
1D Compatibility (Hydrophobicity) : 0.50
QMean score : 0.087

(partial model without unconserved sides chains):
PDB file : Tito_5A1F.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5A1F-query.scw
PDB file : Tito_Scwrl_5A1F.pdb: