Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKDKLRYAILKEIFE-GN---TPLSENDIGVTEDQFDDAVNFLKREGYIIGVHYSDDRPHLYKLGPELTEKGENYLKENGTWSKAYKTIKEIKDWIK 1Z91 Chain:A ((41-116)) -----PQYLALLLLWEHETLTVKKM-GEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERS---VLISLTEDGALLKEKAVDIPG-------------

General information: TITO was launched using: RESULT: Template: 1Z91.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 197 -28811 -146.25 -400.15 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -146.25 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.626

(partial model without unconserved sides chains): PDB file : Tito_1Z91.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Z91-query.scw PDB file : Tito_Scwrl_1Z91.pdb: