Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRLVEENKLKQKLGHKQADSILTLLKLANEKHITL 1FX7 Chain:A ((1-64)) MNELVD---------TTEMYLRTIYDLEEEGVTPL----------------RARIAERLDQSGPTVSQTVSRMERDG---LLRVAGDRHLEL

General information: TITO was launched using: RESULT: Template: 1FX7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 194 -24795 -127.81 -387.41 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -127.81 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.264

(partial model without unconserved sides chains): PDB file : Tito_1FX7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FX7-query.scw PDB file : Tito_Scwrl_1FX7.pdb: