Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEEEKAVSLAKEIIELDIKRDEMLETFMQLAGEQAFQLLRSVQNGQYRKSS 3CS5 Chain:A ((12-59)) VEQQFDLQKYRQQVR-DISREDLEDLFIE--VVRQKMAHENIFKGMIRQGS

General information: TITO was launched using: RESULT: Template: 3CS5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 24 -2501 -104.19 -52.09 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -104.19 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.394

(partial model without unconserved sides chains): PDB file : Tito_3CS5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CS5-query.scw PDB file : Tito_Scwrl_3CS5.pdb: