Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIITALKAVLEEIGADVEIEETVESEKCCDSLRKKNLDY 3CMC Chain:O ((61-96)) ----------------------GNNLVVNGKEIIVKAE-RDPENLAWGEIGVDIVVEST-----------------

General information: TITO was launched using: RESULT: Template: 3CMC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain O - contact count / total energy / energy per contact / energy per residue : 44 -47 -1.07 -1.31 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain O : 0.67 3D Compatibility (PKB) : -1.07 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.407

(partial model without unconserved sides chains): PDB file : Tito_3CMC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CMC-query.scw PDB file : Tito_Scwrl_3CMC.pdb: