Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMLEQLIQLKQDLIDGSKVEKPSLDDKQIDEMDILVSEALEFNKELKFKLFNKGFVENVTGRVHYINFEQQKLHVKDQNDNTVYINMNNIIRVIYND 5I21 Chain:A ((10-48)) ---------------------------------PYLNTLRKERVPVSIYLVNG---IKLQGQIESFD--QFVILLKN--------------------

General information: TITO was launched using: RESULT: Template: 5I21.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 90 -16071 -178.57 -412.08 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -178.57 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.785

(partial model without unconserved sides chains): PDB file : Tito_5I21.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5I21-query.scw PDB file : Tito_Scwrl_5I21.pdb: