Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------------------------------------------------------MIAKMMEALDGERFDIIMEKTLKGMTRVMIWGCLPYFLYVLIRMFTN------------------------------------------------------------------- 1PP0 Chain:A ((5-198)) NVFQPVDQLPEDLIPSSIQVLKFSGKYLKLEQDKAYFDWPGFKTAIDNYTGEDLSFDKYDQSTINQQSQEVGAMVDKIAKFLHDAFAAVVDLSKLAAIILNTFTNLEEES----SSGFLQFNTNNVKKNSSWEYRVLFSVPFAPSYFYSLVTTILITADIEEKTGWWGLTSSTKKNFAVQIDALELVVKKGFKAP

General information: TITO was launched using: RESULT: Template: 1PP0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 69 -5770 -83.62 -134.17 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -83.62 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.266

(partial model without unconserved sides chains): PDB file : Tito_1PP0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PP0-query.scw PDB file : Tito_Scwrl_1PP0.pdb: