Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------MAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMGGQFH------------------------- 3T7Z Chain:A ((1-119)) MIYVTFTPYGAFGVKDNKEVSGLEDIEYKKLFNEEEIPDIMFKLKTQPNKIADELKEEWGDEIKLETLSTEPFNIGEFLRNNLFKVGKEL--GYFNNYDEFRKKMHYWSTELTKKVIKSYA

General information: TITO was launched using: RESULT: Template: 3T7Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 231 24794 107.33 354.19 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 107.33 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.665

(partial model without unconserved sides chains): PDB file : Tito_3T7Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3T7Z-query.scw PDB file : Tito_Scwrl_3T7Z.pdb: