Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVYSDRQLAKDQAARLRQGFSAYAETNSLASLIKKELQSHNLQVYEDLTDFGCWFIPVTDEH 2VT1 Chain:B ((25-48)) --------------------------TNQCALAVRKYANEVGIPTVRDVK-------------

General information: TITO was launched using: RESULT: Template: 2VT1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 11 -745 -67.73 -31.04 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -67.73 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.782

(partial model without unconserved sides chains): PDB file : Tito_2VT1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2VT1-query.scw PDB file : Tito_Scwrl_2VT1.pdb: