Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MEESHAVREMIKIIAKW-DPFKYGEEFYETEAVDVVQAVYDENDPDL--LAKSIQQIFETSFEQTLPIASCREVAGQLLFIKNSSSCTP 1UJ8 Chain:A ((4-76)) SHHHHHHGSGL-----KWTDSREIGEALYDA---------YPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEA---

General information: TITO was launched using: RESULT: Template: 1UJ8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 231 13899 60.17 201.43 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 60.17 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.170

(partial model without unconserved sides chains): PDB file : Tito_1UJ8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1UJ8-query.scw PDB file : Tito_Scwrl_1UJ8.pdb: