Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYIDITIDLKHYN-GSVFDLRLSDYHPVKKVIDIAWQAQSVSMPPREGHWIRVVN--KDKVFSGECKLSDCGITNGDRLEIL 3RT3 Chain:B ((3-73)) --WDLTV---KMLAGNEFQVSLSSSMSVSELKAQITQKIGVHA-----FQQRLAVHPSGVALQDRVPLASQGLGPGSTVLL-

General information: TITO was launched using: RESULT: Template: 3RT3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 225 2131 9.47 31.33 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain B : 0.63 3D Compatibility (PKB) : 9.47 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.576

(partial model without unconserved sides chains): PDB file : Tito_3RT3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3RT3-query.scw PDB file : Tito_Scwrl_3RT3.pdb: