Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMIL---------IQNAEFELVHNFKDGFNEEAFKARYSDILNKY-DYIVGDWGYGQLRLKGFFDDQNQK-ATFETKISTLDEYIYEYCNFGCAYFVLKRIRK
3WX4 Chain:A ((1-98))MIIDSQSVVQYTFKIDILEKLYKFLPNLYHSIVNELVEELHLENNDFLIGT--YKDLSKAGYFYVIPAPGKNIDDVLKTIMIYVHDYEI--EDYFELEHHHH


General information:
TITO was launched using:
RESULT:

Template: 3WX4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 277 14356 51.83 165.01
target 2D structure prediction score : 0.56
Monomeric hydrophicity matching model chain A : 0.61

3D Compatibility (PKB) : 51.83
2D Compatibility (Sec. Struct. Predict.) : 0.56
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.371

(partial model without unconserved sides chains):
PDB file : Tito_3WX4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3WX4-query.scw
PDB file : Tito_Scwrl_3WX4.pdb: