Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MANEFRVCDDCQATNIKTLLPRLKEVDPDAKVEVGCQSYCGPGRKKSFAFVNNRPLSAPTEDELIDKVKKKIKK 1BI6 Chain:H ((13-25)) ----------------------------------DCPGFCKTCKAEF---------------------------

General information: TITO was launched using: RESULT: Template: 1BI6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 8 -1191 -148.81 -91.58 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain H : 0.62 3D Compatibility (PKB) : -148.81 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.745

(partial model without unconserved sides chains): PDB file : Tito_1BI6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1BI6-query.scw PDB file : Tito_Scwrl_1BI6.pdb: