Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------MGTVNIQVEIDP---EAYVTGLEHAKETKLMPEELLEGENNG-
1R75 Chain:A ((12-132))VTFKNGKPTVKGTKTYPMFSNILYRIADTEARRWAFYNDSKELIIHVAVLFDYDSQIVPLGDTTAFRIGKYLCEVDVRPLETQMFVEGSVTGWRVDTLEARTAEDERGYR


General information:
TITO was launched using:
RESULT:

Template: 1R75.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 4562 for 122 contacts (37.4/contact) +
2D Compatibility (PS) -4227 + (NN) 2352 + (LL) 0
1D Compatibility (HY) -1600 + (ID) 350
Total energy: 737.0 ( 6.04 by residue)
QMean score : 0.196

(partial model without unconserved sides chains):
PDB file : Tito_1R75.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1R75-query.scw
PDB file : Tito_Scwrl_1R75.pdb: