Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------MPKERRSRRRPQPIIRWVSL--TLTLLALCQPIQT---------WRCSLSLGNQQWMTTYNQEAKFFISIDQILEAHNQ------SPFCPRSPRYTLD---FVNGYPKI-------YWPPPQGRRRFGARAMVTYDCEPRCPYVGADHFDCPHWD------------NASQADQGSFYVNHQTLFLHLK------QCHGIFTLTWEI-WGYDPLITFSLHKIPDPPQ---------
1L0V Chain:B ((1-243))AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNN---VPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR


General information:
TITO was launched using:
RESULT:

Template: 1L0V.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -60718 for 1161 contacts (-52.3/contact) +
2D Compatibility (PS) -17855 + (NN) 83 + (LL) 368
1D Compatibility (HY) -4800 + (ID) 1500
Total energy: -84422.0 ( -72.71 by residue)
QMean score : ?

(partial model without unconserved sides chains):
PDB file : Tito_1L0V.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1L0V-query.scw
PDB file : Tito_Scwrl_1L0V.pdb: