Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------MPIKKKVMMCLAVTLVF--GSMSFPTLTNSGGFKESTDRNTTYIDHSPYKLSDQKKALS-------------------
1H4L Chain:D ((147-293))STSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPL----KPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES


General information:
TITO was launched using:
RESULT:

Template: 1H4L.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 110 -14629 -132.99 -276.02
target 2D structure prediction score : 0.62
Monomeric hydrophicity matching model chain D : 0.54

3D Compatibility (PKB) : -132.99
2D Compatibility (Sec. Struct. Predict.) : 0.62
1D Compatibility (Hydrophobicity) : 0.54
QMean score : 0.340

(partial model without unconserved sides chains):
PDB file : Tito_1H4L.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1H4L-query.scw
PDB file : Tito_Scwrl_1H4L.pdb: