Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK 1Y74 Chain:A ((17-73)) LGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT

General information: TITO was launched using: RESULT: Template: 1Y74.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 100 -474 -4.74 -10.09 target 2D structure prediction score : 0.17 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -4.74 2D Compatibility (Sec. Struct. Predict.) : 0.17 1D Compatibility (Hydrophobicity) : 0.65 QMean score : -0.192

(partial model without unconserved sides chains): PDB file : Tito_1Y74.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y74-query.scw PDB file : Tito_Scwrl_1Y74.pdb: