Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------MGKKHRNRITGQKKNNHIPEKDI------------IAAEEAHGKEYSAAKRKP 4UI9 Chain:M ((1-67)) MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPESVKEQEMKWTDLALQYLHE

General information: TITO was launched using: RESULT: Template: 4UI9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain M - contact count / total energy / energy per contact / energy per residue : 24 3814 158.90 93.01 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain M : 0.62 3D Compatibility (PKB) : 158.90 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.743

(partial model without unconserved sides chains): PDB file : Tito_4UI9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4UI9-query.scw PDB file : Tito_Scwrl_4UI9.pdb: