Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKCIQIEMSFTDEYGQVTRLNKTYKPSIIEEHKGEIPRLLLDDFKRFLSSLGFNEKQVSRIVTED 4ORR Chain:A ((155-177)) -----------------------------------PRAELKEKFTAFCKAQGFTEDTI-------

General information: TITO was launched using: RESULT: Template: 4ORR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 23 -2135 -92.83 -92.83 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -92.83 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.708

(partial model without unconserved sides chains): PDB file : Tito_4ORR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ORR-query.scw PDB file : Tito_Scwrl_4ORR.pdb: