Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIRSNLKSIIDERKISIRKLSRDIDHEYPTVRKLYNDEMERYPRDLLDKVCTYLNIELQELLIFEKSHNHIDHSG 1DW9 Chain:A ((14-75)) -LADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQ-QALPADAARLVGAKLDLDEDSILLL-----------

General information: TITO was launched using: RESULT: Template: 1DW9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 225 -42958 -190.92 -692.87 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -190.92 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.825

(partial model without unconserved sides chains): PDB file : Tito_1DW9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DW9-query.scw PDB file : Tito_Scwrl_1DW9.pdb: