Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----MEKLFKEVKLEELENQ-----KGSGLGKAQC----------AALWLQCASGGTIGCGGGAVACQNYRQFCR-----
3C0F Chain:B ((3-87))IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG


General information:
TITO was launched using:
RESULT:

Template: 3C0F.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 99 3527 35.62 62.97
target 2D structure prediction score : 0.29
Monomeric hydrophicity matching model chain B : 0.64

3D Compatibility (PKB) : 35.62
2D Compatibility (Sec. Struct. Predict.) : 0.29
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.040

(partial model without unconserved sides chains):
PDB file : Tito_3C0F.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3C0F-query.scw
PDB file : Tito_Scwrl_3C0F.pdb: