Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----MEKLFKEVKLEELENQ-----KGSGLGKAQC----------AALWLQCASGGTIGCGGGAVACQNYRQFCR----- 3C0F Chain:B ((3-87)) IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG

General information: TITO was launched using: RESULT: Template: 3C0F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 99 3527 35.62 62.97 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain B : 0.64 3D Compatibility (PKB) : 35.62 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.040

(partial model without unconserved sides chains): PDB file : Tito_3C0F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C0F-query.scw PDB file : Tito_Scwrl_3C0F.pdb: