Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------MMEQGKDCREVVTQLAASRNAIDRAMGLIVSTNLEHCVRESLEKGEDTQNLVKEAVDLLVKSR
2HH7 Chain:A ((4-88))ELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKF---


General information:
TITO was launched using:
RESULT:

Template: 2HH7.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 110 13992 127.20 233.20
target 2D structure prediction score : 0.70
Monomeric hydrophicity matching model chain A : 0.68

3D Compatibility (PKB) : 127.20
2D Compatibility (Sec. Struct. Predict.) : 0.70
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.454

(partial model without unconserved sides chains):
PDB file : Tito_2HH7.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HH7-query.scw
PDB file : Tito_Scwrl_2HH7.pdb: