Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSYCGTCMESLFALVNGEVVMG----ETPAELVENIYTFIEENPMF 3C7M Chain:A ((161-194)) -------------------------------------------QGVPAYVVNGKYLIYTKSIKSIDAMADLIRELAS-----

General information: TITO was launched using: RESULT: Template: 3C7M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 48 -10817 -225.35 -360.57 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -225.35 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.576

(partial model without unconserved sides chains): PDB file : Tito_3C7M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C7M-query.scw PDB file : Tito_Scwrl_3C7M.pdb: