Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKPVMLSVYGAENVCASCVNMPTAKDTYEWLEAALKRKYPNQPFEMQYIDIHEPPDNEHAKELAEKIRNDEYFYPLVLVEDKIVGEGNPKLKDVYEEMEKHGYTENR 1H75 Chain:A ((2-76)) -----RITIYTRND-CVQCHATK------RAME--------NRGFDFEMINVDRVPEA---AEALRA--QGFRQLPVVIAGDLSW--SGFRPDMINRLHPAP------

General information: TITO was launched using: RESULT: Template: 1H75.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 291 -41745 -143.45 -556.60 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -143.45 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.355

(partial model without unconserved sides chains): PDB file : Tito_1H75.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1H75-query.scw PDB file : Tito_Scwrl_1H75.pdb: