Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIALLGGAVAIDGDSLLPVFVIIGGAVIYFL---VVIGIIIWNVIQGIKVLRAA 4BUR Chain:C ((459-487)) --------------------------------------------------------------------------------GKGVIFYLRDKVVVGIVLWNIFNRMPIAR--

General information: TITO was launched using: RESULT: Template: 4BUR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 40 -13597 -339.93 -522.96 target 2D structure prediction score : 0.04 Monomeric hydrophicity matching model chain C : 0.49 3D Compatibility (PKB) : -339.93 2D Compatibility (Sec. Struct. Predict.) : 0.04 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.894

(partial model without unconserved sides chains): PDB file : Tito_4BUR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4BUR-query.scw PDB file : Tito_Scwrl_4BUR.pdb: