Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKEKLSDHLKSEWKKIDQTANPSIPNQKELLHQLSQMKAEYRKKLLQEIILFVFCALMVVSAAILAFTQAPAVFIVLQVCVLAVLPILIAAEKKRHLGEC-----EVKRG 2D9K Chain:A ((1-75)) -GSSGSSGHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGN-----------------------------------CGRNVLVKDLKTHPEVCGREGSGPSSG

General information: TITO was launched using: RESULT: Template: 2D9K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 149 -1079 -7.24 -15.41 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : -7.24 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.154

(partial model without unconserved sides chains): PDB file : Tito_2D9K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2D9K-query.scw PDB file : Tito_Scwrl_2D9K.pdb: