Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKILGVTGFILICLLAISVLMDMLQGFSLTKAVYNNMSSFKMTTFAEWVVLLFFVLVLVREMYVIYKSKKKNP 2KPA Chain:A ((1-26)) -----------------------------------------------VSVDPFYEMLAARKKRISVKKKQEQP

General information: TITO was launched using: RESULT: Template: 2KPA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 18 -1549 -86.06 -59.58 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain A : 0.47 3D Compatibility (PKB) : -86.06 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.47 QMean score : 0.513

(partial model without unconserved sides chains): PDB file : Tito_2KPA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KPA-query.scw PDB file : Tito_Scwrl_2KPA.pdb: