Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MANSNNKTNAQQVRKQNQQSASGQGQFGTEFASETNVQQVRKQNQQSAAGQGQFGTEFASETDAQQVRQQNQSAEQNKQQNS-------------------- 1S79 Chain:A ((100-202)) GRWILKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVE

General information: TITO was launched using: RESULT: Template: 1S79.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 278 2724 9.80 33.21 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 9.80 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.164

(partial model without unconserved sides chains): PDB file : Tito_1S79.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1S79-query.scw PDB file : Tito_Scwrl_1S79.pdb: