Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------------------------------MDLN-LRHAVIANVTGNNQEQLEHTIVDAIQSGEEKMLP--GLGVLFEVIWQHASESE-KNEMLKTLEGGLKPA-E-------------------- 4YO5 Chain:A ((399-529)) AALSLEPEALQIADNEGTEAALSWLQARPGIQSDRSNWLLRLLMAR---VAEQTGKN-DLALHLLAELDERATRLTLSQWEPELVFEVKARRLKLLRMKSAKTESDRVRLQPDMEHLLAGLIAIDAARAAVLCNS

General information: TITO was launched using: RESULT: Template: 4YO5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 193 8990 46.58 134.18 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : 46.58 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.375

(partial model without unconserved sides chains): PDB file : Tito_4YO5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YO5-query.scw PDB file : Tito_Scwrl_4YO5.pdb: